Protein Info for B158DRAFT_0906 in Kangiella aquimarina DSM 16071

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details PF06127: Mpo1-like" amino acids 2 to 146 (145 residues), 65.5 bits, see alignment E=2e-22

Best Hits

KEGG orthology group: None (inferred from 96% identity to kko:Kkor_2083)

Predicted SEED Role

"Putative PRS2 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>B158DRAFT_0906 Predicted membrane protein (Kangiella aquimarina DSM 16071)
MRSGQEWIAEYSESHRNPTNKLLHWICVPTIMWTVLAFLWVIPVPEVMQLHPLVNWVVIF
IAVAQLFYISFGWKIFSGMLLVSILMLWFTYWLDSVVSIPLWQIALVVFIIAWIGQFIGH
HIEGKKPSFFKDLLFLLVGPAWEMNYFLRQIGWLR