Protein Info for B158DRAFT_0905 in Kangiella aquimarina DSM 16071

Annotation: large conductance mechanosensitive channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details TIGR00220: large conductance mechanosensitive channel protein" amino acids 3 to 132 (130 residues), 173.2 bits, see alignment E=1.3e-55 PF01741: MscL" amino acids 3 to 131 (129 residues), 167 bits, see alignment E=1.2e-53

Best Hits

Swiss-Prot: 70% identical to MSCL_PSEPG: Large-conductance mechanosensitive channel (mscL) from Pseudomonas putida (strain GB-1)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 92% identity to kko:Kkor_2084)

MetaCyc: 59% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>B158DRAFT_0905 large conductance mechanosensitive channel protein (Kangiella aquimarina DSM 16071)
MGMVSEFKKFAMKGNVVDMAVGIIIGGAFGKIVSSFVNDVLMPPLGILLGGMDFKDLAFT
IKEASGEQAAVTLNYGSFIQTAVDFIIIAFAIFMMIKAMNRLSKKEEKKPAAPPKPSAEQ
ELLTEIRDLLKQDRV