Protein Info for B158DRAFT_0896 in Kangiella aquimarina DSM 16071

Annotation: phosphate regulon sensor kinase PhoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details PF11808: PhoR" amino acids 7 to 89 (83 residues), 85.7 bits, see alignment E=5.9e-28 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 96 to 425 (330 residues), 433 bits, see alignment E=6.8e-134 PF00989: PAS" amino acids 100 to 153 (54 residues), 30.8 bits, see alignment 6.4e-11 PF13426: PAS_9" amino acids 109 to 198 (90 residues), 26.2 bits, see alignment E=2e-09 PF00512: HisKA" amino acids 206 to 271 (66 residues), 66.9 bits, see alignment E=3.3e-22 PF02518: HATPase_c" amino acids 318 to 424 (107 residues), 96.4 bits, see alignment E=3.5e-31

Best Hits

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 96% identity to kko:Kkor_2093)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>B158DRAFT_0896 phosphate regulon sensor kinase PhoR (Kangiella aquimarina DSM 16071)
MWTNRYWQTEVWTLAFIILVVGLIGSLFDRAAASVAVVIFAYLFWNLVQLSRLYRWLVKS
RALYPPSAPGIWGEIFNHLYVLQRKHRKELKKLKGIISEFRASTSALKDGALIISNQGEI
RWFNRAAERLLGLKSSTDIGQRLFNLLRHPSFIEYEQTRDYNKPLIINSPADERIILNIR
ITPYNDDQRLVIIRDITEKQHLERVRQDFVANVSHELRTPLTVITGYLEMLDPETNPQLE
SVAKPLQMMRQQALNMGHLVDDLLLLSKLDAKAEENGKQEVDINLMLDSICAEARSLSGE
KEHQILFHSHTNTNLYGSEKQLRSAFSNLIFNAVRYTQAKGRIDIFWKEDDSNLILQVQD
NGPGIAEEHIPRLTERFYRVDSGRNRSQGGTGLGLAIVKHVLEGHNGKLKIQSELGKGST
FSCVFVKVK