Protein Info for B158DRAFT_0891 in Kangiella aquimarina DSM 16071

Annotation: ABC-type uncharacterized transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 746 transmembrane" amino acids 31 to 58 (28 residues), see Phobius details amino acids 452 to 474 (23 residues), see Phobius details amino acids 487 to 506 (20 residues), see Phobius details amino acids 513 to 535 (23 residues), see Phobius details amino acids 549 to 568 (20 residues), see Phobius details amino acids 598 to 620 (23 residues), see Phobius details amino acids 645 to 667 (23 residues), see Phobius details amino acids 711 to 732 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 553 to 740 (188 residues), 55.8 bits, see alignment E=2.5e-19

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 95% identity to kko:Kkor_2098)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (746 amino acids)

>B158DRAFT_0891 ABC-type uncharacterized transport system, permease component (Kangiella aquimarina DSM 16071)
MNTSVKETTRKLLDQQTQSGKHKRRKINDLIARYSIGLGGLSVIGAVGLICFYLFWVVFP
IFKPASVELEQDYSWQQTQPQYMAVEEYGEIAFSISKSGDLGFFSVEDGNIINKARFSHN
AQPTAFAELDLKGLMAAGFADGSFQLFSHKYKISYPNNERHIEPQLQYPFGEDSLELTDT
AITRLFGSRWEDGIVIASVGADQKVTTVTYSIDQSFLTEELTLEEESRDSFEIPFTPKYV
LTTPGPDWLYIISEQGDLIAYRHIDDEWEFHESQSLLESGKTVTEATFLLGQTSLLIGDS
DGVVSQWFQVRGEQGFNLKKIRDFKLSDSPISQIIIEKRRKGFIASDANGKMGIFYTTSE
RQLEEFDFGQKLQALAINSRSNRLVGIGENGQATVFSVENEHPEISWSALWNEVWYESYE
EPSFTWQSSASTNDFESKFSLVPLSFGTLKAAIYAMLFAVPLAIFGAIFTAYFMAPKMRS
MVKPTVEIMEALPTVILGFLAGLWLAPLIEEHLAGVILLIILLPIVTVLFGFTWTKLPGA
IKHRVPDGWQAALLFPIIIFGTFLAFWLGEPVESAMFNGNMPAWLNEQGITYDQRNSLVV
GIAMGFAVIPTIFSITEDAIFSVPKHLSNGSLALGASQWQTLTRVVIPTASPGIFSALMI
GLGRAVGETMIVLMATGNTPIMDMNIFEGFRTLSANIAVEMPESEVGSSHYRVLFLAAFV
LFLFTFVFNTIAEIVRQRLRNKYGSL