Protein Info for B158DRAFT_0867 in Kangiella aquimarina DSM 16071

Annotation: biotin biosynthesis protein BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 20 to 266 (247 residues), 246.3 bits, see alignment E=2e-77 PF13489: Methyltransf_23" amino acids 41 to 182 (142 residues), 68.5 bits, see alignment E=3e-22 PF01728: FtsJ" amino acids 42 to 123 (82 residues), 25.1 bits, see alignment E=8e-09 PF05175: MTS" amino acids 42 to 149 (108 residues), 27 bits, see alignment E=1.6e-09 PF01209: Ubie_methyltran" amino acids 50 to 165 (116 residues), 50.6 bits, see alignment E=8.8e-17 PF07021: MetW" amino acids 53 to 142 (90 residues), 21.6 bits, see alignment E=7.4e-08 PF13847: Methyltransf_31" amino acids 55 to 173 (119 residues), 68.4 bits, see alignment E=3e-22 PF03141: Methyltransf_29" amino acids 55 to 152 (98 residues), 27.4 bits, see alignment E=6.4e-10 PF13649: Methyltransf_25" amino acids 56 to 146 (91 residues), 89.1 bits, see alignment E=1.3e-28 PF08242: Methyltransf_12" amino acids 57 to 148 (92 residues), 58.7 bits, see alignment E=4e-19 PF08241: Methyltransf_11" amino acids 57 to 150 (94 residues), 100.7 bits, see alignment E=2.9e-32

Best Hits

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 87% identity to kko:Kkor_2130)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>B158DRAFT_0867 biotin biosynthesis protein BioC (Kangiella aquimarina DSM 16071)
MSKATQARINQISKGDIARSFSRAANTYDDAAFFQRVAGERLLERLQYFKLQPSDILDLG
CGTGHFTRELSRRYPSAKVTGADLAEGMIDFCRAQSNQEDYVCADALKLPFESNSFDFVF
SNLTIQWVEELPQLFQELNRVLKPEGLLLFTTLGPDTLYELKQSWAAVNDYQHVNNFIDM
HHVGDAMLSARLSDPVVDNEPVVIGYNRAIELMRDLKNIGAHNIDSSRNHGLTSPRQLRK
LEQEYSKFKMDDGQLPATYELVYGHAFGTETSSAVGYHDYAVEIG