Protein Info for B158DRAFT_0866 in Kangiella aquimarina DSM 16071

Annotation: putative pimeloyl-BioC--CoA transferase BioH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR01738: pimelyl-[acyl-carrier protein] methyl ester esterase" amino acids 12 to 255 (244 residues), 278.3 bits, see alignment E=3e-87 PF12146: Hydrolase_4" amino acids 17 to 241 (225 residues), 60 bits, see alignment E=3.3e-20 PF00561: Abhydrolase_1" amino acids 17 to 244 (228 residues), 106.3 bits, see alignment E=3.3e-34 PF12697: Abhydrolase_6" amino acids 17 to 244 (228 residues), 70.7 bits, see alignment E=4.3e-23

Best Hits

Swiss-Prot: 50% identical to BIOH_AERS4: Pimeloyl-[acyl-carrier protein] methyl ester esterase (bioH) from Aeromonas salmonicida (strain A449)

KEGG orthology group: K02170, biotin biosynthesis protein BioH (inferred from 93% identity to kko:Kkor_2131)

Predicted SEED Role

"Biotin synthesis protein BioH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>B158DRAFT_0866 putative pimeloyl-BioC--CoA transferase BioH (Kangiella aquimarina DSM 16071)
MSKLQPYIESTGQGPDLVLLHGWGLHSGIWEMLADDLAEHFTLHMIDLPGFGRSPIPGDP
YTLNLLTEQVLKVAPDNAHYLGWSLGGLVATNIAIETPERVNKLITVASNPRFVQEDDWQ
HAMKANIMDSFCRYLEEDYQGTIIRFLAIQAIGSETQKEDIRRLRDTVFIHGVPAGKALR
GGLALLNEVDLRSELSRVKAPMLRLYGRLDSLVPAKTAEQVAELVPHSQHKVYPKASHAP
FLSHKPLFVNDVKEFLHE