Protein Info for B158DRAFT_0859 in Kangiella aquimarina DSM 16071

Annotation: putative efflux protein, MATE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 129 to 146 (18 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 232 to 238 (7 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 271 to 296 (26 residues), see Phobius details amino acids 313 to 339 (27 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 384 to 430 (47 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 16 to 413 (398 residues), 229.9 bits, see alignment E=2.5e-72 PF01554: MatE" amino acids 16 to 176 (161 residues), 85.3 bits, see alignment E=1.9e-28 amino acids 239 to 400 (162 residues), 78 bits, see alignment E=3.6e-26

Best Hits

KEGG orthology group: None (inferred from 94% identity to kko:Kkor_2137)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>B158DRAFT_0859 putative efflux protein, MATE family (Kangiella aquimarina DSM 16071)
MLNKDRSQQVLQISLPIVGGMISQNVLNLVDAAMVGTQGSAAIAAIGIAGFINFMAVAFF
IGFAAGVQAMVSRRMGEGRQSEAAYPLNAALLIIGLMALPTSIILFFLAPDILSSLNSDP
ELLEEGIPYLQARFAGILAIGLNFSYRSYWSAIKQTGYYLRTLLVMHSLNILLNYTLIFG
NFGMPELGTLGAGIGTSISLAMGSIYYHILATKHTKQFGYMERLAALATIKSIFRISLPS
SIQQLFFAGGFTALFWIIGQVGTHQLAAANAITNVMLVAILPCIALGIGAATMVGQALGK
QDPNDAYLWGWDVAKMALIFATALATLFFIFTDPIMGIFLKEPTALQIAHWPFKLSAGII
IIDAMGLVFLNALNGAGYTKPPMYVSLLSQWLIFLPVAWLLGPYFGFGLMTIWLAYAAYR
VLQTGAFIWLWQRRTWADAVVD