Protein Info for B158DRAFT_0858 in Kangiella aquimarina DSM 16071

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 143 to 170 (28 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 264 to 294 (31 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 439 to 456 (18 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 107 to 218 (112 residues), 27.6 bits, see alignment E=8.9e-11 amino acids 232 to 450 (219 residues), 47.3 bits, see alignment E=9.2e-17

Best Hits

KEGG orthology group: None (inferred from 53% identity to ilo:IL2378)

Predicted SEED Role

"Methionine transporter MetT" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>B158DRAFT_0858 Na+/H+ antiporter (Kangiella aquimarina DSM 16071)
MSKKLATSPGLSSVGTSESITETRHSKVSSHNPAHWLALLPLVLFLVLFLGSGIYYTTLG
VEYAFYQLPAPVAVLPAIAVALFLAKGTFESRIAILLKGIGDSNIVAMCLIYLLAGAFAA
LTGVIGAIDAVVNFGLYWIPPGFILPGLFVIAAVVSFAMGTSMGTLAALAPIGFGLSQTA
GLEPAIVAGILLSGAMFGDNLSVISDTSIAATRTQGATVGEKLRQNARWAIPAAIITISS
FSLIPTEPSQAEVADYQLYKVIPYLAIVILALTGLSVFIILPAGIIVSIGIGLISGSFTV
DNSVAQTIYQGFSNMQEIFLLSLLIGGLGALIEKQGGLQWLVNKISQLFAASQSKLRAQL
AVLSTAAVTNLAVANNTVSIILTGKVTQSLANQGNIEPMRSASLVDIGACSTQGILPYGA
QCLLLGASFGISPLEPVQYVWYLPILLAVVFSSLLFRKGA