Protein Info for B158DRAFT_0853 in Kangiella aquimarina DSM 16071

Annotation: IscR-regulated protein YhgI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF01521: Fe-S_biosyn" amino acids 2 to 99 (98 residues), 48.8 bits, see alignment E=7.4e-17 TIGR03341: IscR-regulated protein YhgI" amino acids 2 to 192 (191 residues), 304.4 bits, see alignment E=1.6e-95 PF01106: NifU" amino acids 112 to 178 (67 residues), 74.3 bits, see alignment E=6.7e-25

Best Hits

Swiss-Prot: 67% identical to NFUA_YERPN: Fe/S biogenesis protein NfuA (nfuA) from Yersinia pestis bv. Antiqua (strain Nepal516)

KEGG orthology group: K07400, Fe/S biogenesis protein NfuA (inferred from 98% identity to kko:Kkor_2142)

MetaCyc: 66% identical to iron-sulfur cluster carrier protein NfuA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NfuA Fe-S protein maturation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>B158DRAFT_0853 IscR-regulated protein YhgI (Kangiella aquimarina DSM 16071)
MITISEAAQEHFRRLLAGQEEPDTGIRVFVVNPGTSHAECGVSYCPPDAIEDTDTELKFD
GFSAFIDEDSAPYLEEAEIDYSKEQTGGQLTLRAPNAKARKVDDDAPASDRIRYYLESEI
NPELANHGGQVSLVEFTQSGIAVLQFGGGCQGCGMVDVTLKEGIEKTLIERVPEVKGVKD
VTEHSEGENPYY