Protein Info for B158DRAFT_0823 in Kangiella aquimarina DSM 16071

Annotation: putative glycoprotease GCP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 3 to 314 (312 residues), 445.9 bits, see alignment E=7.1e-138 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 4 to 306 (303 residues), 405.3 bits, see alignment E=1.6e-125 PF00814: TsaD" amino acids 24 to 307 (284 residues), 327.8 bits, see alignment E=3.2e-102

Best Hits

Swiss-Prot: 70% identical to TSAD_SHEAM: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 91% identity to kko:Kkor_2172)

MetaCyc: 69% identical to N6-L-threonylcarbamoyladenine synthase, TsaD subunit (Escherichia coli K-12 substr. MG1655)
RXN-14570 [EC: 2.3.1.234]

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.234 or 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>B158DRAFT_0823 putative glycoprotease GCP (Kangiella aquimarina DSM 16071)
MKILGIETSCDETGIAIYDSEQGIIADALFSQIKLHAEYGGVVPELASRDHVRKTIPLIK
KVMAESGCTPADIDAIAYTKGPGLIGALFVGVGIGRSLAYAWDVPAIGVHHMEGHLLAPM
LEDDKPEFPFVALLVSGGHSMLVDVQSLGHYTILGESIDDAAGEAFDKTAKIMGLGYPGG
PALAKLAEKGRPGIYKLPRPMTDRPGLDFSFSGLKTAVANLYRDSDKTEQDLADIAYAFQ
EAVVDTIYIKCRRALEQTGYQSLVVAGGVSANISLREKLTSLLESKGGKAYYPRLQFCTD
NGAMIAYAGYCRYQQIISQQGQFEEPAVRAQPRWPIADLG