Protein Info for B158DRAFT_0794 in Kangiella aquimarina DSM 16071

Annotation: DnaJ-domain-containing proteins 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 26 (3 residues), see Phobius details PF05099: TerB" amino acids 55 to 163 (109 residues), 66.6 bits, see alignment E=2.4e-22 PF00226: DnaJ" amino acids 206 to 266 (61 residues), 44.1 bits, see alignment E=1.8e-15

Best Hits

Swiss-Prot: 46% identical to DJLA_VIBCH: Co-chaperone protein DjlA (djlA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K05801, DnaJ like chaperone protein (inferred from 91% identity to kko:Kkor_2209)

Predicted SEED Role

"DnaJ-like protein DjlA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>B158DRAFT_0794 DnaJ-domain-containing proteins 1 (Kangiella aquimarina DSM 16071)
MSWFGKVLGGVIGFSLGGPIGAILGGVVGHQIDKKNDDGLEPGSQERVQAAFFTATFSVM
GHIAKADGRVTETEIRHAEEVMRRMGLDQTARKLAIDLFSQGKERDFDLHGVLEQFKREC
QRRRNLMQMFMEVQISMAMADGVVHQQERTVLHEVGKSLGFPAFMIDQLIKMVQAQQRFY
QHSRQQGGEHGGPGYQPASGPSVEQAYQVLGVKSGDDQQTVKRAYRRLMSQHHPDKLVAK
GLPEQMIKMATEKTQEIKAAYELIKRHKNW