Protein Info for B158DRAFT_0793 in Kangiella aquimarina DSM 16071

Annotation: Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00483: NTP_transferase" amino acids 2 to 218 (217 residues), 101.7 bits, see alignment E=5.1e-33 PF12804: NTP_transf_3" amino acids 3 to 134 (132 residues), 54.8 bits, see alignment E=1.3e-18

Best Hits

Swiss-Prot: 51% identical to MURU_PSEAE: N-acetylmuramate alpha-1-phosphate uridylyltransferase (murU) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 89% identity to kko:Kkor_2210)

Predicted SEED Role

"Nucleotidyl transferase possibly involved in threonylcarbamoyladenosine formation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>B158DRAFT_0793 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) (Kangiella aquimarina DSM 16071)
MKAMILAAGRGERMRPLTDERPKPLLKVNGKALIEWHIEALKEAGIREIIINTSWLGDLI
PEYLGDGAYWGVNLSFSPEEEALETAGGIRKALDFFEDQPFIVINGDVWTDMDYTRIAKA
PENSAHIVLVPNPEHHPEGDFCVTEGGKVKSEGDPKLTFSGIGVYHPHIFKELPKDEAFP
LGPLLRELMAQEEVTYDLYEGRWHDIGTPERLQKLNESFQRKLKTIEFNLENDK