Protein Info for B158DRAFT_0790 in Kangiella aquimarina DSM 16071

Annotation: periplasmic chaperone for outer membrane proteins SurA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF09312: SurA_N" amino acids 24 to 141 (118 residues), 112.3 bits, see alignment E=4.8e-36 PF13624: SurA_N_3" amino acids 26 to 141 (116 residues), 45.3 bits, see alignment E=2.6e-15 PF13616: Rotamase_3" amino acids 165 to 271 (107 residues), 77.4 bits, see alignment E=4e-25 amino acids 277 to 378 (102 residues), 84 bits, see alignment E=3.7e-27 PF13145: Rotamase_2" amino acids 170 to 274 (105 residues), 37.4 bits, see alignment E=1.3e-12 amino acids 296 to 384 (89 residues), 30 bits, see alignment E=2.3e-10 PF00639: Rotamase" amino acids 175 to 269 (95 residues), 85.1 bits, see alignment E=1.7e-27 amino acids 285 to 376 (92 residues), 84.5 bits, see alignment E=2.6e-27

Best Hits

Swiss-Prot: 44% identical to SURA_NITOC: Chaperone SurA (surA) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 88% identity to kko:Kkor_2213)

MetaCyc: 38% identical to chaperone SurA (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>B158DRAFT_0790 periplasmic chaperone for outer membrane proteins SurA (Kangiella aquimarina DSM 16071)
MILKKALVGFTLCLAAFSLQAEVIDKVIAHVDEDVILQSELDRKIVQAKQQIRSRGGQLP
PEDVLRKELLEQLIIQNLQYQIALRSGMQIQPAELQQYANQVAKNSGMSLEEFRLSLAQQ
GISYELFLNDLRKEILTGQLRDALVARRIKISDKEIDSLIQSMNAQNQVEYNLGHILIAV
PENADEQTESQAKQKALSVIKELKAGADFAETAKAVSSSPDAAEGGDFGWRTESTMPTLF
ANVVSFLRKGEVSQPIRSPSGFHVLKIKDKRGDQQHLVQQTNARHILIRPDAITTEADAK
QQLSNIRQRVLAGDADFAEEAKKHSDDPGSAKLGGDLGWNNLGVYDPVFEQTLANLEVNE
ISEPFQSSFGWHIVQLLGRRTDDQTDAMKRQQALRILQQRKFGEEVENWIRELRDEAYVK
KIVEEDA