Protein Info for B158DRAFT_0788 in Kangiella aquimarina DSM 16071

Annotation: dimethyladenosine transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF00398: RrnaAD" amino acids 10 to 261 (252 residues), 251.6 bits, see alignment E=3.7e-79 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 11 to 261 (251 residues), 304 bits, see alignment E=3.9e-95

Best Hits

Swiss-Prot: 58% identical to RSMA_PSEPF: Ribosomal RNA small subunit methyltransferase A (rsmA) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02528, 16S rRNA (adenine1518-N6/adenine1519-N6)-dimethyltransferase [EC: 2.1.1.182] (inferred from 87% identity to kko:Kkor_2215)

MetaCyc: 52% identical to 16S rRNA (A1518/A1519-N6-dimethyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11633 [EC: 2.1.1.182]

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>B158DRAFT_0788 dimethyladenosine transferase (Kangiella aquimarina DSM 16071)
MSKSRMVQGHQARKRFGQNFLSDNHYIQRIVESVAAQSDDRLVEIGPGLGAITEHLVDKV
AELHVVELDRDLIPRLEQKFASRENFTIHHGDALKFDFGQLAGNQQIRVVGNLPYNISTP
LIFHLLNQRQSIKDMYFMLQKEVVERICAQPGTSSYGRLSVMTQYYCQADMLFLVPPGAF
QPPPKVESAIVRLQPYSTLPSPVKDEKLLNQIVTAAFGQRRKTLRNSLKNFIDEAGLEQL
GIKPSERAEQLSLAQFVDICRKVEQNQAD