Protein Info for B158DRAFT_0762 in Kangiella aquimarina DSM 16071

Annotation: type IV pilus secretin (or competence protein) PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details PF11741: AMIN" amino acids 68 to 143 (76 residues), 31.5 bits, see alignment E=3.2e-11 amino acids 174 to 272 (99 residues), 57.3 bits, see alignment E=2.8e-19 TIGR02515: type IV pilus secretin PilQ" amino acids 290 to 691 (402 residues), 504.4 bits, see alignment E=1.4e-155 PF07660: STN" amino acids 315 to 362 (48 residues), 39 bits, see alignment 1.1e-13 PF03958: Secretin_N" amino acids 388 to 460 (73 residues), 55.7 bits, see alignment E=9.2e-19 PF00263: Secretin" amino acids 529 to 691 (163 residues), 177.4 bits, see alignment E=3.8e-56

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 87% identity to kko:Kkor_2241)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (696 amino acids)

>B158DRAFT_0762 type IV pilus secretin (or competence protein) PilQ (Kangiella aquimarina DSM 16071)
MKNTNHLWTNKSQLGKSTMLTKTTTFMKSCSVFAFAMLASWGVHASQLEAINYNVLPGDK
VQLRMTYSDVPPTPQEFTTANPARISMDFEGVDSGLDFKTKEIGVGVVNSVTAIQAQNRT
RVVINLSELVSYNSQIEGSDYVITLEQGSVASNSGTKPSRTSSYSTDSGYDISSIDFRRG
VNGEGRVLVNLGNPSVSVDLRQEGRTVIADFMGADIDPAFIRRLDVIDFGTPAQIVETTS
RGNAVRLAIRANDTFEYLAYQANNQYTIELKPLTQKEIEKREREQPKYSGERLTLQFQDM
DLKAILHTLGDFAGINIVISDDVQGSMALNLVNVPWDQALDIILKSKGLGKRQDGNVMMI
APADVIAEREQQELEANKQQEELAPLRTELIQVNYAKAPEIAAILKSGLGSDEGQSVGVL
SERGSVSVDQRTNTILVQDVATKLEDVRRLVAQLDIPVRQVLIEARIVTADDGFARDLGS
RFGVSDVMNSGEVNSDFNVNLPIANPAGSLGLSFARLQDGIVVDMELSALESENRGEVVA
SPKVITANQKEAYIKAGEEIPYQQSSGGAGGQTTIQFKEAVLELRVTPQITPDGNVILDL
RIIQDTRGESLIFDGVAAAPAINTQEVGTQVLVENGETIVLGGIFQHRTTYDESKVPLLG
DIPLLGWLFKNTQREDTKQELLIFVTPKIIEQGLKN