Protein Info for B158DRAFT_0748 in Kangiella aquimarina DSM 16071

Annotation: ATP-dependent protease HslVU, peptidase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00227: Proteasome
  • amino acids 5 to 173 (169 residues), 85.7 bits, E=1.7e-28
• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 7 to 177 (171 residues), 288.8 bits, E=6e-91

Best Hits

Swiss-Prot: 89% identical to HSLV_TERTT: ATP-dependent protease subunit HslV (hslV) from Teredinibacter turnerae (strain ATCC 39867 / T7901)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 99% identity to kko:Kkor_2255)

MetaCyc: 79% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Protein Sequence (179 amino acids)

>B158DRAFT_0748 ATP-dependent protease HslVU, peptidase subunit (Kangiella aquimarina DSM 16071)
MEQYRGTTILSVRRNGTVVIGGDGQVSLGNTIMKGNARKVRRLYNDQVIAGFAGGTADAF
TLFERFEKKLEAHGGKLMRAAVELAKDWRTDRALRRLEALLAVADKENSLIITGNGDVIQ
PEDDLIAIGSGGPFAQSAAKALLQKTDLSAREIVETGLTIAGDVCIYTNHNQTIEELSY