Protein Info for B158DRAFT_0746 in Kangiella aquimarina DSM 16071

Annotation: Subtilisin-like serine proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF05922: Inhibitor_I9" amino acids 37 to 118 (82 residues), 33.1 bits, see alignment E=1.1e-11 PF00082: Peptidase_S8" amino acids 156 to 377 (222 residues), 166.7 bits, see alignment E=1.2e-52 PF04151: PPC" amino acids 427 to 494 (68 residues), 73.7 bits, see alignment E=2.8e-24 amino acids 535 to 602 (68 residues), 68.6 bits, see alignment E=1.1e-22

Best Hits

KEGG orthology group: K14645, serine protease [EC: 3.4.21.-] (inferred from 94% identity to kko:Kkor_2257)

Predicted SEED Role

"peptidase S8 and S53, subtilisin, kexin, sedolisin"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (616 amino acids)

>B158DRAFT_0746 Subtilisin-like serine proteases (Kangiella aquimarina DSM 16071)
MKLNQVVAGVLLATGVTGAYAGEFKAAAQPEKAVKGQYIVVLKDDAVTANMGLFSSNASE
QAIAMVSDNLSRKYQAQVQRTFTKAVKGGVFNMSEKAAQKLAQDPNVLLVEEDQIVSINA
TQNNATWGLDRIDQRNLPLSGSYTYNTTASNVNAYIIDTGILGSHSEFSGRFMGGYDFVD
NDSNPNDCNGHGTHVAGTVGGSTYGVAKGVKLYGLKVLGCNGSGTNSGVIAGIDWVANNH
VKPAVANMSLGGGASSATDNAVANLVASGVTVAVAAGNDNSNACNYSPAREPSAITVGST
TSSDSRSSFSNYGSCLDIYAPGSSITSAWSNGGTNTISGTSMASPHVAGVAALYLANNPN
ATPAQVEAAIENAATSGKVSDAKSGSPNLLLYSLFDGSTPPPPPPPGGNELENGVSVTFS
GAQGSETDFTFDVPSSASNVSFDMSGGTGDADIYVKFGSAPTTSSYDCRPYRNGNTESCD
FSAQAGTYYVMVRGYTSYSNVNLVATHDGGGTNPPPAGGSATLENLSGASGSFTHYYVDI
PAGMSSLNVQMSGGSGDADLYVRRGSQPTTSSYDCRPYKYGNNESCSFSNPAQDRWYISI
RGYSSYSGVTLQVDWQ