Protein Info for B158DRAFT_0744 in Kangiella aquimarina DSM 16071

Annotation: ubiquinone/menaquinone biosynthesis methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF01209: Ubie_methyltran" amino acids 24 to 254 (231 residues), 339.5 bits, see alignment E=3.1e-105 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 29 to 254 (226 residues), 286.9 bits, see alignment E=4.2e-90 PF13489: Methyltransf_23" amino acids 60 to 237 (178 residues), 49.3 bits, see alignment E=1.7e-16 PF13847: Methyltransf_31" amino acids 66 to 233 (168 residues), 68.6 bits, see alignment E=1.8e-22 PF01135: PCMT" amino acids 66 to 172 (107 residues), 25.5 bits, see alignment E=3.8e-09 PF13649: Methyltransf_25" amino acids 71 to 168 (98 residues), 76.6 bits, see alignment E=6.9e-25 PF08241: Methyltransf_11" amino acids 72 to 172 (101 residues), 72 bits, see alignment E=1.8e-23 PF08242: Methyltransf_12" amino acids 72 to 170 (99 residues), 44.5 bits, see alignment E=7.4e-15

Best Hits

Swiss-Prot: 76% identical to UBIE_YERE8: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 94% identity to kko:Kkor_2259)

MetaCyc: 73% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-) @ 2-heptaprenyl-1,4-naphthoquinone methyltransferase (EC 2.1.1.163)" (EC 2.1.1.-, EC 2.1.1.163)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>B158DRAFT_0744 ubiquinone/menaquinone biosynthesis methyltransferases (Kangiella aquimarina DSM 16071)
MTEHDKNTSDNTTHFGYQTVDKSQKAAKVAEVFHSVAAKYDVMNDLMSFGVHRVWKRYTI
ERAAARSGQTILDIAGGTGDLTAKFSKIVGPSGKVVLADINESMLKVGRNKLVDSGIVGN
VEYVQANAECLPFPDNYFDRITIAFGLRNVTEKEKALESMYRILKPGGKLLVLEFSKPVL
PALSKVYDVYSFSLLPAMGKVVANDSESYKYLAESIRMHPDQETLKQMMSEAGFDEVEYT
NLTGGIVALHIGKKF