Protein Info for B158DRAFT_0742 in Kangiella aquimarina DSM 16071

Annotation: 2-octaprenylphenol hydroxylase (EC 1.14.13.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 transmembrane" amino acids 501 to 520 (20 residues), see Phobius details amino acids 526 to 545 (20 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 10 to 445 (436 residues), 584.4 bits, see alignment E=5.8e-180 PF03109: ABC1" amino acids 93 to 343 (251 residues), 269.6 bits, see alignment E=1e-84

Best Hits

Swiss-Prot: 56% identical to UBIB_SHEAM: Probable protein kinase UbiB (ubiB) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 95% identity to kko:Kkor_2261)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>B158DRAFT_0742 2-octaprenylphenol hydroxylase (EC 1.14.13.-) (Kangiella aquimarina DSM 16071)
MNAIRQLHHALKINRTLVHYGLDEFLAPTPLARFRPLAKLFSLSLRRKAKDKSRGERLRL
ALTELGPIYVKLGQMLSTRRDLVPPDIADELAKLQDQVPPFDSNIARSIVEKQLATAIDD
VFSNFNDTPLASASIAQVHEATLNSGEEVVVKILRPGIRQKIMRDMQMMHSMARWAEKYS
SEARRLRAIEVVKEYDSTLAREIDLRIEAANTSHLRHNFENSDLLYVPKIYWDYTRVKML
VMEKISGIPIGNIEALRTSGVDMKALADRGVEIFFTQVFRDSFFHADMHPGNIFVNVSNP
GAPQYIAIDCGIMGTLDENDKRYLADNFLAFFDRNYRRIAELHVESGWIDADVSIPEFES
AIRAACEPIFGKSLAEISFGHFLIQLFQTARRFNMQVQPQLVLLQKTLLYIEGLGRQLYP
QLDLWQTAQPYLKQWVREQIGPKAMFEDIKRQFPDWLNKAPKLPGLLFDNLHRVGHSLNQ
FEQLKSQFTELERHKLQQQYALKHAFIGGSLAILSGISYLAVPTDWWPAAILGAGAGWFL
IKSLWPTK