Protein Info for B158DRAFT_0729 in Kangiella aquimarina DSM 16071

Annotation: 1-acyl-sn-glycerol-3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 334 to 358 (25 residues), see Phobius details amino acids 377 to 396 (20 residues), see Phobius details amino acids 403 to 435 (33 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 316 (283 residues), 57.3 bits, see alignment E=2e-19 PF05977: MFS_3" amino acids 62 to 310 (249 residues), 31.6 bits, see alignment E=9.5e-12 PF01553: Acyltransferase" amino acids 440 to 568 (129 residues), 92.7 bits, see alignment E=2.7e-30

Best Hits

KEGG orthology group: None (inferred from 85% identity to kko:Kkor_2275)

Predicted SEED Role

"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.51

Use Curated BLAST to search for 2.3.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (625 amino acids)

>B158DRAFT_0729 1-acyl-sn-glycerol-3-phosphate acyltransferase (Kangiella aquimarina DSM 16071)
MANQFSLFKKRFFSSYFVTQALGALNDNVYKSALLIFIAYQASAELNLNSDMLNNIAAGL
FILPFFLFSATAGQIAEKFEKSALIRKIKLLEITIMICAVIGFYLNNIWFLLLVLFLMGF
QSSLFGPIKYSILPQHLDDSELLGGNGLVEMGTFLSIIIGTVIGGVLIGRGDIGVQILSG
LLLAISITGYLASRRIPETPSTQSDLKINWNPITQTWKTFKFARQQKVVFLSILGVSWFW
FYGAVFLTQIPNFTKVSLNGNDLVATMILATFSVGIGLGSVLCEFLSGRKVELGLVPFGA
IGMTWFAIDIFLANPNSSFTGALSPTEYLSQDGAIRTLINCAFVGIFGGFYIVPLYALIQ
ERCERSHLSRVIAGNNILNALFMVVAAVLGAVLLGNGMTIPQFFLLVAIMNALVAIYIFT
LVPEFLMRFLVWILIHTVYRVRKKGLDNIPDEGAQVLVCNHVSYVDALIIAGSIRRPVRF
VMYHKIFKIPVLSFIFRTAKAIPIAGANEDKELLNKAMYQIAEALENGEVVCIFPEGKLT
TDGEMNAFKSGIERIIETTPVPVIPMALQGLWQSLFSRKKVNKIIDRLKRIRTKVTLIVG
EPIPHQDVTKEHLQEVVTELRDNKP