Protein Info for B158DRAFT_0721 in Kangiella aquimarina DSM 16071

Annotation: Predicted redox protein, regulator of disulfide bond formation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01206: TusA
  • amino acids 5 to 74 (70 residues), 86.3 bits, E=4.9e-29

Best Hits

Swiss-Prot: 37% identical to TUSA_COLP3: Sulfur carrier protein TusA (tusA) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: K04085, tRNA 2-thiouridine synthesizing protein A [EC: 2.8.1.-] (inferred from 86% identity to kko:Kkor_2283)

MetaCyc: 35% identical to TusA sulfur-carrier protein (Allochromatium vinosum)
2.8.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

• sulfur oxidation IV (intracellular sulfur) (2/7 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (4/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Protein Sequence (77 amino acids)

>B158DRAFT_0721 Predicted redox protein, regulator of disulfide bond formation (Kangiella aquimarina DSM 16071)
MSNKHTLDCSNLLCPMPVIRTQNALKELNEGDTLEVICTDPGTLSDIPTWCRINQQEVLS
TEEIDNQIIFTIKKTAI