Protein Info for B158DRAFT_0712 in Kangiella aquimarina DSM 16071

Annotation: Glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 7 to 86 (80 residues), 22 bits, E=4.3e-08
• PF03807: F420_oxidored
  • amino acids 7 to 94 (88 residues), 30.7 bits, E=1.2e-10
• PF01210: NAD_Gly3P_dh_N
  • amino acids 8 to 162 (155 residues), 168.5 bits, E=3.4e-53
• PF02558: ApbA
  • amino acids 8 to 112 (105 residues), 40.9 bits, E=4.9e-14
• PF07479: NAD_Gly3P_dh_C
  • amino acids 182 to 322 (141 residues), 190.9 bits, E=3.9e-60
• PF20618: GPD_NAD_C_bact
  • amino acids 242 to 308 (67 residues), 90.3 bits, E=2.7e-29

Best Hits

Swiss-Prot: 60% identical to GPDA_COLP3: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 91% identity to kko:Kkor_2293)

MetaCyc: 57% identical to glycerol-3-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase (NAD(P)(+)). [EC: 1.1.1.94]

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• CDP-diacylglycerol biosynthesis III (4/5 steps found)
• glycerol-3-phosphate shuttle (1/2 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• 1,3-propanediol biosynthesis (engineered) (3/9 steps found)
• superpathway of phospholipid biosynthesis II (plants) (11/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Protein Sequence (336 amino acids)

>B158DRAFT_0712 Glycerol-3-phosphate dehydrogenase (Kangiella aquimarina DSM 16071)
MSAPLSFAVLGAGSYGTALAVLLARNGHRVQLWARNAEHVAEMQQARNNSKYLPDVAFPE
NLSVTDNVESALADHPIILVAVPSHAFRDTLHLVKPYVDKSSRLVWASKGLDPESGDLLG
NVLKSILGSDMPHAILSGPTFAKEMAIGMPTAITLAANNDEFAEQLALALHNERFRVYTS
DDIVGVQVGGAVKNVVAIGAGIADGLGYGANARTALITRGLVEMTRLGVAAGGKQETFNG
MAGMGDLVLTCTDNQSRNRRFGLALGKGASREEAEHAIGQVVEGVRNAKEVKMLAERLNV
EMPISDAIYRIIYEGVDARQAAHELLTRDLKSEGLK