Protein Info for B158DRAFT_0704 in Kangiella aquimarina DSM 16071

Annotation: C-terminal peptidase (prc)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 62 to 373 (312 residues), 292.8 bits, see alignment E=1.6e-91 PF00595: PDZ" amino acids 102 to 172 (71 residues), 34.1 bits, see alignment E=6e-12 PF13180: PDZ_2" amino acids 106 to 185 (80 residues), 48.7 bits, see alignment E=1.5e-16 PF17820: PDZ_6" amino acids 120 to 173 (54 residues), 43.2 bits, see alignment 5.7e-15 PF03572: Peptidase_S41" amino acids 204 to 367 (164 residues), 169.7 bits, see alignment E=8.1e-54

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 77% identity to kko:Kkor_2301)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>B158DRAFT_0704 C-terminal peptidase (prc) (Kangiella aquimarina DSM 16071)
MKRIVLGCIIMLMLPKAALAEHPHENPELQKPQPESSIETLPLDELAALADVYAEIKKSY
VHELTDKEILDGAIRGMLYNLDPYSSYLNADEFAQLEETATGDYAGIGIEALHLEDGIKV
MAVVADSPAKAAGLQVNDLITAIGDVSAKGLSDVEGSDLMRGPPGSKVTLTVIKAVNNKT
ETITITRQIIHTTSVRYELLEKGIGYAHINEFQIRTANDLSKAISAMEKQNKTPLAGFIL
DLRNNPGGLLDGAIEVSDLFLNEGIIVSTKGRLPEGNDSYTATSGDILGGKPMVVLVNGS
SASASEIVAGALQDHHRGFIFGTQSYGKAMVQTILPIHGGNAVKLTTALYYTPSGKSIQG
AGITPDTLVEFETLDASENGRLATRAGEVLNDYQKDNQVMAALNHLLATKSSDTP