Protein Info for B158DRAFT_0697 in Kangiella aquimarina DSM 16071

Annotation: Type II secretory pathway, component PulL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 261 to 283 (23 residues), see Phobius details PF05134: T2SSL" amino acids 5 to 247 (243 residues), 118.1 bits, see alignment E=4.1e-38 PF12693: GspL_C" amino acids 255 to 408 (154 residues), 51.7 bits, see alignment E=9.5e-18

Best Hits

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 80% identity to kko:Kkor_2308)

Predicted SEED Role

"General secretion pathway protein L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>B158DRAFT_0697 Type II secretory pathway, component PulL (Kangiella aquimarina DSM 16071)
MKDRLFIRLKSDEESLEWGLMTHEESVPKFSEQGELLLDDMIALAEQAAQNEVVLLLPAS
RVRCFNVKAPTRNRKQLEKAVPYILEEQVLENVEQQLFALGSINASGMVAVNVVDKSYLE
DVLERLKNASIEPDYVVSDASCLPLFDDAWSVLEHDDSILVRQSANEYWSTEADMLSDLM
SWNLQTQFEENQTVSQAVRIYSPDENTNLLAGIAGLAIQKMPVENSFEWLCSQFNYSLLN
LLQQEFSSQKKHQVNLGQWKMPAIAAIALIAVGFIYLISQMIVLNQQKNQYEQQILTSIQ
QVFPNVSDVNTGLIQVSNRFSTLGGDAASANSFMLLLDKSLAAIDPQTIKVSQLEYLSSM
AQLSFDVETSDYSTLTAAQNKLEATGMQVEMRNASESGGTWSARISVGVKQ