Protein Info for B158DRAFT_0691 in Kangiella aquimarina DSM 16071

Annotation: general secretion pathway protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 170 to 194 (25 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 375 to 399 (25 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 405 (402 residues), 508.4 bits, see alignment E=8.6e-157 PF00482: T2SSF" amino acids 73 to 195 (123 residues), 116 bits, see alignment E=5.4e-38 amino acids 275 to 397 (123 residues), 99.2 bits, see alignment E=8.8e-33

Best Hits

Swiss-Prot: 51% identical to GSPF_VIBCH: Type II secretion system protein F (epsF) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 98% identity to kko:Kkor_2314)

MetaCyc: 43% identical to type II secretion system protein GspF (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>B158DRAFT_0691 general secretion pathway protein F (Kangiella aquimarina DSM 16071)
MAAFEYVALDARGKQKKGVLEADTPRQIRQQLREKDMTPLEVVHIGDAQKAREKSSGGFF
KPSIKVADLALVTRQLATLVKAALPIEEALKAVADQTDKGKVKSIILGVRAKVLEGHTLA
DGMAEFPNVFNELYRSMVAAGERAGHLDKVLNRLADYTERRQKINSKVSAAMVYPVVLIL
VAVGVVSGLMVFAVPKVVEQFTHMSQELPVLTKILIGISDFVINYGLYVLILLILMFIGM
RYWLRNEDNKRRWHAKILKMPVFGRLSSNLNTAQFSSTLSILHSSGVPLLEAMNIGGKVL
SNLKMRQAVKEAAIKVREGSSLKVALQQSSLFPPMMIHMIGSGEASGELEQMLQQVSDNQ
ESLFENSVDVALNIMGPLIILALGGMVMFIVLAMMLPIFELTNSITS