Protein Info for B158DRAFT_0689 in Kangiella aquimarina DSM 16071

Annotation: general secretion pathway protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 710 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 38 to 110 (73 residues), 82.5 bits, see alignment E=2.3e-27 TIGR02517: type II secretion system protein D" amino acids 38 to 653 (616 residues), 522.4 bits, see alignment E=7.6e-161 PF03958: Secretin_N" amino acids 137 to 196 (60 residues), 40.3 bits, see alignment 4.6e-14 amino acids 202 to 269 (68 residues), 49.4 bits, see alignment E=6.4e-17 amino acids 276 to 364 (89 residues), 49.8 bits, see alignment E=4.7e-17 PF00263: Secretin" amino acids 483 to 644 (162 residues), 163.9 bits, see alignment E=4e-52

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 95% identity to kko:Kkor_2316)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (710 amino acids)

>B158DRAFT_0689 general secretion pathway protein D (Kangiella aquimarina DSM 16071)
MIQRLKKIRMKQLGSSLTMSLCAAGLLLSSFSANAERLNVRDADIREVVETVAKITGKTM
IVDPRVKGLKVTIITAGNVDYTKDQIYNIFVSALQVHKFQAIEANGVVKIVPDQQARSEY
SPVNVSNLDDYGDRYITQVIPVQNVDAQQIMNVLRPLVSPTSGHLFAVQGTNTLILHDSA
SNVRRISEIIDRTDKANDEEIEVIPLEHASASEIVRILESLNRSGRQQQGNEVQEPRYVA
DERTNSILLSANDRQRVRLRALISSLDRPLNSMGNTKTVFLKYAKAEQVAEVLSGIGEIK
QKEEAAASGRGGAGTAGTGGIAAQRSLYSIQPHEETNALVLTAPPDIMREFDSVIRALDI
RRKQVHVEAIIVEISDNKAKELGIQWLFSPEGSSTTPGGVVNFTNTGPGIGQVAAGAISA
RGTEEEVFVRDPDTGVITGTETIRTGGDNGAALAEVLGGMQGLGLGVARIRPDGFSWGAF
IRALEGVTDSNTLSRPSVTTLDNVEAIFKSGQEIPIITGSTLGDNNSNPFQNVERKDVGV
MLKLTPQINEGNYVRLDIEQEVSSIAGSTNVDVVTNKREVKTSVLVPDGGMVVLGGLIDD
DIQQSSQKVPILGDIPVLGHAFKSQRTQKIKRNLMIFIHPTVLKDDEELREISSAKYSYI
RAQQIEQANRGISLMPEEDSEVLPTYDEALVLPPTYEEYMLDEDGEAKED