Protein Info for B158DRAFT_0686 in Kangiella aquimarina DSM 16071

Annotation: Disulfide bond chaperones of the HSP33 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF01430: HSP33" amino acids 3 to 272 (270 residues), 251 bits, see alignment E=7.7e-79

Best Hits

Swiss-Prot: 38% identical to HSLO_SERP5: 33 kDa chaperonin (hslO) from Serratia proteamaculans (strain 568)

KEGG orthology group: K04083, molecular chaperone Hsp33 (inferred from 80% identity to kko:Kkor_2319)

Predicted SEED Role

"33 kDa chaperonin (Heat shock protein 33) (HSP33)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>B158DRAFT_0686 Disulfide bond chaperones of the HSP33 family (Kangiella aquimarina DSM 16071)
MSDLIQRFTFADLPIRGEIISLEKSFQTICDQHQYSKTLRHLLGEALAATALMAEIIKIE
GRVSLQLQSPSQVKLLVTECNNHGHIRGVMHPLDPEVSDYNFKQWTQGGTLAITIEPEQG
HRYQGIVSLEKESLSECLEDYFTSSEQLPTYLKLFVGENRINGVFLQAMPDDSSQQKDKA
AAFEHVTTLAETITDEEALSLSHHDLLYRLFHQDKVTLYDAKPIQFQCGCSRERNERALL
TIEPQELMQLAEEHDGKVELVCDFCSKKEVFTQQEIAELVTTNQGSQSVN