Protein Info for B158DRAFT_0685 in Kangiella aquimarina DSM 16071

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details PF00672: HAMP" amino acids 174 to 225 (52 residues), 30.2 bits, see alignment 6.9e-11 PF00512: HisKA" amino acids 230 to 285 (56 residues), 46 bits, see alignment 6.7e-16 PF02518: HATPase_c" amino acids 329 to 433 (105 residues), 85.3 bits, see alignment E=6.1e-28

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 96% identity to kko:Kkor_2320)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>B158DRAFT_0685 Signal transduction histidine kinase (Kangiella aquimarina DSM 16071)
MRILPKTAFGRIAVLVGCLLLINQWVSYLSISWYVAQPSMKQLVQLLSADVKTSLELQAL
EFEGKIDGSVRQQIMDNQRIQFISTRMGEPKQLREARPYSVLTEQLAESLGVSESQTEMR
VEESDNIYYWIKSPQHTNVWLRIAMDPFEGFYIHPPVVYISVILLLSLLGGWIFTKQISR
PLRRLEFAAREIGRGDNPGQLKEEGLEEMVTVTRAFNQMARNVQQLEQDRNLLLAGVSHD
LRTPLTRIRLATEFMGDADEELREGIVRDTEDMDQIIDQFISFVRDGRDEREQLGDLNAL
VEECIKSVRLQTQDISFELGKLPKIYFKPLAMKRLITNLIMNGLKYAGPPLKVTTTLNNN
MIQLSVLDEGPGIKDAEMEHLFQPFSRGDSARSGGGSGLGLAIVRRIAEMHGGTVTLHNR
AEKGLEARLQIPVH