Protein Info for B158DRAFT_0679 in Kangiella aquimarina DSM 16071

Annotation: FKBP-type peptidyl-prolyl cis-trans isomerases 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01346: FKBP_N" amino acids 46 to 159 (114 residues), 82.1 bits, see alignment E=4.5e-27 PF00254: FKBP_C" amino acids 167 to 254 (88 residues), 105.4 bits, see alignment E=1.6e-34

Best Hits

Swiss-Prot: 35% identical to MIP_LEGLO: Outer membrane protein MIP (mip) from Legionella longbeachae

KEGG orthology group: K03772, FKBP-type peptidyl-prolyl cis-trans isomerase FkpA [EC: 5.2.1.8] (inferred from 86% identity to kko:Kkor_2326)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FklB (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>B158DRAFT_0679 FKBP-type peptidyl-prolyl cis-trans isomerases 1 (Kangiella aquimarina DSM 16071)
MKQLTIKKTALVLALSAALVACEQSGDKKESTDGAQQAVEFKGEYDKAAYAIGVNFSKQM
GQNFESLKEYGIEINPQIVAEGIKDGFAGNAQLTDEEVDEQMEAFQNNLNTKMEEHQAKL
EAEAQQEAEANLAEGAAFREEYAKKEGVQTTESGLMYRVIEASGSEESPAAEDTVRVHYR
GTFIDGKEFDSSYERKQPIDFPLRGVIPGWTEGVQLMNVGDKYEFVIKPELAYGEMDRGT
IPGNSTLVFEVELLEINPTEPVQPDPEPTIDEQMEEHVEEAAQELEQAAEETQETVEEAA
QEVEEEVKEATGDDQ