Protein Info for B158DRAFT_0677 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized small membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details PF04241: DUF423" amino acids 19 to 103 (85 residues), 82.5 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 47% identical to Y230_STAEQ: UPF0382 membrane protein SERP0230 (SERP0230) from Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

KEGG orthology group: None (inferred from 91% identity to kko:Kkor_2328)

Predicted SEED Role

"COG2363"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>B158DRAFT_0677 Uncharacterized small membrane protein (Kangiella aquimarina DSM 16071)
MKKHFILHGAMFMALGVALGAVGSHALELSSDMQRLFELGVQYQIYHALGLIAVGLISGC
LANTKGELAGWLMFAGIVGFSGGLYFYALTGNELIRKVIPLGGSLLIISWLVFFWAVLTS
KVKQFD