Protein Info for B158DRAFT_0670 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized protein required for cytochrome oxidase assembly

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 79 to 96 (18 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 277 to 294 (18 residues), see Phobius details amino acids 306 to 332 (27 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details PF02628: COX15-CtaA" amino acids 8 to 347 (340 residues), 269 bits, see alignment E=2.6e-84

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 93% identity to kko:Kkor_2333)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>B158DRAFT_0670 Uncharacterized protein required for cytochrome oxidase assembly (Kangiella aquimarina DSM 16071)
MQKKTLRKFAIFASILALCVILLGAWTRLSDAGLGCPDWPGCYGHFTVPQDADYIKQAEV
EYNQVFEADKAWPEMIHRHFAKAIGLVIIILFVGAWKGRRKDPSIPVLLPSILLPLVIFQ
GLLGMWTVTLKVHPFVVMLHLLGGFSILSLLFLYILQLRPKIVSLSQVVAKKFKKLAMVS
LVLVILQIALGGWTAANYAATACTELPFCNDGWTQNVDFKGGYDLWQKGFEFDEFKALEQ
EKFEADLAKAQGEPFINYEGGVLSHDQKVAIHVSHRIGAYIVFLIVGLLALLMIREKDSV
LIRHFGRALALVLIGQMLLGFSNIIFALPLYVAVAHNGGGAILLLTVLAVNFLVNWQFRQ
AKQVGGKHG