Protein Info for B158DRAFT_0631 in Kangiella aquimarina DSM 16071

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details PF00512: HisKA" amino acids 219 to 281 (63 residues), 46.3 bits, see alignment E=3.5e-16 PF02518: HATPase_c" amino acids 327 to 429 (103 residues), 81.5 bits, see alignment E=6.4e-27

Best Hits

KEGG orthology group: None (inferred from 87% identity to kko:Kkor_2371)

Predicted SEED Role

"two-component system sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>B158DRAFT_0631 Signal transduction histidine kinase (Kangiella aquimarina DSM 16071)
MTQKRRGIHYKIIKAMAIQLLLISAVTLLGVYGAAKVVENVLIKQALEGEADFFWKNYEK
NPDFNLPSTLNLTGYMSSSQPSDDVPDYLESLQPGYQRVDFNHRQPLVHISEQYGKRLYL
VFEEGQVARLSFYFGIAPLAFVLLIIYLPAWIMYMLSRRAISPVVKLSRLMDSVEVSERA
DLKMDFSDIEKNADAEVMTLLQAFDQYAERVNEYVTREKNFTRYASHELRTPLAVLKGSI
SLLEKQQLNDSQLKVVSRMKPMVKEMEDLLEALFLLSRDQEPDISEEPVNVNAVVKQHFT
SIERLFADKNIETSLHSNVQLKMRISERLLVICLNNIIFNAFNYTEQGTIEVFIGRSFIR
VSDTGIGMDERSLQRIFEPFYRANREQEQVKGFGLGMAIVKRICDQMDWRISIDSQPGKG
TQIQLTLKEHDK