Protein Info for B158DRAFT_0629 in Kangiella aquimarina DSM 16071

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 186 to 203 (18 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details PF06966: DUF1295" amino acids 21 to 248 (228 residues), 212.2 bits, see alignment E=8.1e-67 PF02544: Steroid_dh" amino acids 136 to 214 (79 residues), 35 bits, see alignment E=1.4e-12

Best Hits

KEGG orthology group: None (inferred from 84% identity to kko:Kkor_2373)

Predicted SEED Role

"FIG005069: Hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>B158DRAFT_0629 Predicted membrane protein (Kangiella aquimarina DSM 16071)
MELDVAIIAVALLCFVGQLIAWLWQFHTKNTDIVDITWALLIVIGGLIYVAMAEGSGFHR
YIVLLIPIAWYARLAWHLIDRYQVEHEDGRYQQLRAHWSENTQSKLFVFFMFQAVLAFAF
SYPVAVIVSSHQDFDIFDGIGIAIAVLSFIGVTLSDYQLRQFKRRKDTKGKVCNIGLWRY
SRHPNYFFEWTHWFAYPLIGWHAEQGWLLWIYPVLMLLFLLKLTGIPFNEQQNIRSKGDA
YREYQRQTNKFFLGPTK