Protein Info for B158DRAFT_0624 in Kangiella aquimarina DSM 16071

Annotation: Fatty-acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 33 to 62 (30 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details PF00487: FA_desaturase" amino acids 49 to 273 (225 residues), 82.1 bits, see alignment E=2.9e-27

Best Hits

KEGG orthology group: K00507, stearoyl-CoA desaturase (delta-9 desaturase) [EC: 1.14.19.1] (inferred from 91% identity to kko:Kkor_2378)

Predicted SEED Role

"Fatty acid desaturase (EC 1.14.19.1); Delta-9 fatty acid desaturase (EC 1.14.19.1)" (EC 1.14.19.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.19.1

Use Curated BLAST to search for 1.14.19.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>B158DRAFT_0624 Fatty-acid desaturase (Kangiella aquimarina DSM 16071)
MKMKQWFDNSQINTDTNQPEQLEGVDWPRVIPYIGLHLVCLFAFVTGVSWTAVIICIAAY
LIRMFAITAFYHRYFSHKSFKTYRWVQAVFGFLGASATQRGPLWWAAHHRHHHIYADTDE
DAHSPRHGFLKSHMLWFLNKKNFPTQEGRVKDLAKYPELRWLDRFDIFPPIIFAALIFGL
GVYLEMFHPELGADRWQVLIWGFFISTILLSHVTYCINSLAHRWGSKRFETNDDSRNNFL
LALLTLGEGWHNNHHFSPGSVKQGFYWWEIDLSFYVLKAMEKLGLVWDLKYPNKELIALK
AKS