Protein Info for B158DRAFT_0612 in Kangiella aquimarina DSM 16071

Annotation: putative oligopeptide transporter, OPT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 383 to 407 (25 residues), see Phobius details amino acids 415 to 434 (20 residues), see Phobius details amino acids 441 to 459 (19 residues), see Phobius details amino acids 479 to 500 (22 residues), see Phobius details amino acids 530 to 549 (20 residues), see Phobius details amino acids 555 to 575 (21 residues), see Phobius details amino acids 596 to 620 (25 residues), see Phobius details amino acids 632 to 655 (24 residues), see Phobius details TIGR00728: oligopeptide transporter, OPT superfamily" amino acids 29 to 616 (588 residues), 211.8 bits, see alignment E=2.1e-66 PF03169: OPT" amino acids 34 to 617 (584 residues), 354.4 bits, see alignment E=7.1e-110 TIGR00733: oligopeptide transporter, OPT family" amino acids 34 to 617 (584 residues), 355.9 bits, see alignment E=3.9e-110

Best Hits

KEGG orthology group: None (inferred from 94% identity to kko:Kkor_2389)

Predicted SEED Role

"oligopeptide transporter, OPT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (664 amino acids)

>B158DRAFT_0612 putative oligopeptide transporter, OPT family (Kangiella aquimarina DSM 16071)
MPQKNKGLDAKAYVPLKEGETYKPYVPAEENIAEFTFKAVGLGILFGIIFGAANAYLGLR
AGLTISTSIPVAVMAVAVFKILSKFGIGSTILETNIAQTTGSASSSLASGVIFTLPALFM
WGVAPDLLQMTILAMSGGVIGILFMIPLRKFLIEREHGKLPYPEGTACAEVLVANEVGGN
KAKYIFYGMGAAALFKTLTSWIKVIPDYAAVKIPFLKKGAIGIDLSAALFGVGYILGPRI
AWVMVGGGLLSAIIIIPAIAYWGDTQTTPFFPETVKLISDMSTGEIWSRYVRYIGAGAVA
TAGIITLIKSVPVMLESFKVGAKNIAKQVDEETHTSKADVAKEPRTHQDLPIKVVFFGIL
AVVLMLTFMPGVFGAVGGIDTRLLAAICVAVFAFFFVTVASRIVGLVGVTSNPTSGMTIA
ALLGTATIFLAMGWTDTSGKAATLIVGCVVAIAASISGDTSQDLKSGYLLGATPRKQQMA
ELIGVLTSATFVCLSVLLLAETFGFGSKELPAPQATLMKLVIDGVLEQNLPWLLVAIGVG
IAIICELVRVPSLPFAVGVYLPLSTMTPILIGGLIRHWVESKTKRDDEKESRREKGILLG
SGFVGGEGLLGVAIAAMAFIEGRKPDGIGTGWIGSDVMAMILGAISFTLLVIWFIKLLKK
RDVA