Protein Info for B158DRAFT_0607 in Kangiella aquimarina DSM 16071

Annotation: Beta-lactamase class C and other penicillin binding proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF17660: BTRD1" amino acids 37 to 82 (46 residues), 32.2 bits, see alignment 8.3e-12 amino acids 87 to 134 (48 residues), 50.8 bits, see alignment 1.2e-17 amino acids 139 to 186 (48 residues), 48.9 bits, see alignment 4.9e-17 amino acids 191 to 237 (47 residues), 30.5 bits, see alignment 2.8e-11 amino acids 243 to 289 (47 residues), 48.5 bits, see alignment 6.5e-17 PF00144: Beta-lactamase" amino acids 304 to 615 (312 residues), 122.3 bits, see alignment E=2.5e-39

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>B158DRAFT_0607 Beta-lactamase class C and other penicillin binding proteins (Kangiella aquimarina DSM 16071)
MSIFARLQSSLIIFSCLFCTSFISSADVLDQPDGPLEWASWRNLSTSTYDQYLNEYKAKG
YRPIDVEIDGGRQRSYSLIMRKDNARVPWAIHTQLTHDGFSAKWNEYKDKGYRPIDLESY
TYKNKQYYAGIWIKDSVTSWASYRNLTSDEFNQKYRENKSKGRMPIDVDGYVVNGKLRFS
GIFVKNDANIGWSIKRNIKQKDFSSHFKDMSDKGYRLYDTNAYKYKSELYFATIWVKPRN
SLRWAARRDMDSDNFHSYWAKYRDAGYRLEDIEVYSGKGGTRYAGVWIENNPVRTRWKHK
AAVEKLVDDYLKDNPAQGFSLVIYQDGKYRFMKGWGYTDKGTSKHAHSKTLYRLASVSKA
ITGTLGHILERKNILELDTPIRDYVSALPSDHQYILEQLLSIRSGVCHYDDNCDGYDGTN
INLSDKNSMWNGVKKFYKKDFSADVGDLYYSTHGYTIAANAYERKANKSFNSLLATYISN
PLGIDIQCEDLDKNRSERSSIFDGNLKKVSAKSIEWKCGGGGMEASVYDIARFGVALEKG
KLLSESEKNDMITPPDGQRRGGNRYANGWAVNPGTDGAAINWYAKAGDQTGGRNYLRIYP
DTDLVIALGANTRGSGYQQLVTDIVNEITK