Protein Info for B158DRAFT_0591 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 571 to 590 (20 residues), see Phobius details TIGR04312: choice-of-anchor B domain" amino acids 167 to 550 (384 residues), 493.1 bits, see alignment E=3e-152 PF08309: LVIVD" amino acids 214 to 240 (27 residues), 11.1 bits, see alignment (E = 1.1e-05) amino acids 266 to 284 (19 residues), 9.3 bits, see alignment (E = 3.7e-05) amino acids 486 to 510 (25 residues), 19.3 bits, see alignment (E = 2.9e-08)

Best Hits

KEGG orthology group: None (inferred from 86% identity to kko:Kkor_2439)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (597 amino acids)

>B158DRAFT_0591 Uncharacterized conserved protein (Kangiella aquimarina DSM 16071)
MKSIITVTGSLGLVLISLLHPPVSAHSGSHPVRYVAANGTDQGDCSKPSAPCASIAYAVN
QSSKGDKIYVASGTYHAGEMDIFYLLNDMVAVKGGFSTKDQFAKQNPEKNLTTITGIPAE
YREKLDSKGFHLLQDAKGLPEQRLKPEYLKLLDRYQKITTSVEKQLTCSGGQAGEYPCYN
VDLESHLPLSQLSSSPSSANDIWGYVDLNNNREYAVMGLFNGTVLIDVSDPVNPVEVDTV
TGANSTWRDVKVYQYFDDAAQQYKAYAYVTTEGQGGLQIIDLSNAPESIELVNTINVFQT
AHNVYLGNIDYANGTALDGHEAYLYIAGSNIDNGSYRVFDLSDPVNPALVTTPSSAGYVH
DATNLIINDARTAQCSDGHNPCEIFVDFNENTVDIWDTTNKSAPFKISSTSYAGASYTHS
GWYSDDKNYVFVQDELDERNRGVNTTLYVMDIQDLTSPRVVGSYVGSTPAIDHNGFTLGD
KYYMSNYKRGLTILDVSNPATPKEIGFFDTYPIPEANDPQFDGAWGAYPYLPSGNILVSD
ISNGLFVLKDNSQIGGTEPPPVPQPEPDSGGGGGGSTSLWLLLGLTLFGLRRKLMPQ