Protein Info for B158DRAFT_0573 in Kangiella aquimarina DSM 16071

Annotation: endoribonuclease L-PSP, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 TIGR00004: reactive intermediate/imine deaminase" amino acids 3 to 123 (121 residues), 167.8 bits, see alignment E=5.6e-54 PF01042: Ribonuc_L-PSP" amino acids 9 to 123 (115 residues), 126.4 bits, see alignment E=3e-41

Best Hits

Swiss-Prot: 67% identical to YVN1_AZOVI: RutC family protein in vnfA 5'region from Azotobacter vinelandii

KEGG orthology group: K07567, TdcF protein (inferred from 94% identity to kko:Kkor_2426)

MetaCyc: 30% identical to 2-amino-5-carboxymuconic 6-semialdehyde deaminase subunit (Bordetella sp. 10d)
3.5.99.-

Predicted SEED Role

"Bona fide RidA/YjgF/TdcF/RutC subgroup"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>B158DRAFT_0573 endoribonuclease L-PSP, putative (Kangiella aquimarina DSM 16071)
MSKTIIQTDKAPAAIGTYSQAVKAGNTVYLSGQIPLIPETMELVESFDDQVHQVFKNLSA
VCEAAGATLNHISKLNIFMTDLGHFATVNEIMAQYFEQPYPSRAAIGVKELPKGAQIEMD
AIVSLDED