Protein Info for B158DRAFT_0555 in Kangiella aquimarina DSM 16071

Annotation: prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 2 to 260 (259 residues), 281.4 bits, see alignment E=3.9e-88 PF01790: LGT" amino acids 8 to 254 (247 residues), 263.3 bits, see alignment E=9.4e-83

Best Hits

Swiss-Prot: 58% identical to LGT_PHOPR: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Photobacterium profundum (strain SS9)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 83% identity to kko:Kkor_2413)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>B158DRAFT_0555 prolipoprotein diacylglyceryl transferase (Kangiella aquimarina DSM 16071)
MNFPKIDPIIFELGPIALRWYGLMYLLGFIAAWVLGNYRAKQPNSGWTQDQVADFLFYAF
IGVIIGGRLGYVMFYGMQWWKEDFWYLFKIWQGGMSFHGGLLGVIGGALYYQYKSKKTFF
EIADFIAPLAPLGLMFGRIGNFINGELWGRQASADFPLAMRFPDDPLGLLRHPSQLYEAV
FEGLVLFIVLWIYSAKPRPRMAVSGVFLLGYGAARFGVEFFREPDAHLGEIISWLTMGQV
LSAPMIIIGIYLLIAAYSKKTK