Protein Info for B158DRAFT_0551 in Kangiella aquimarina DSM 16071

Annotation: NTP pyrophosphohydrolases including oxidative damage repair enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 7 to 130 (124 residues), 87.5 bits, E=4e-29

Best Hits

KEGG orthology group: K08311, putative (di)nucleoside polyphosphate hydrolase [EC: 3.6.1.-] (inferred from 94% identity to kko:Kkor_2449)

Predicted SEED Role

"Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (223 amino acids)

>B158DRAFT_0551 NTP pyrophosphohydrolases including oxidative damage repair enzymes (Kangiella aquimarina DSM 16071)
MIDAEGFRANVGIIICNDQGQLLWTRRFGQTSWQFPQGGVHPGESAEQTMYRELYEEVGL
EKDDVRILGSTQHWYKYRLPQRLVRQNSQPLCIGQKQKWFLLQLLADESKIDFAATDHPE
FDGFIWVNYWYPVRNVVNFKRDVYRAALSELMGSMFRFQFKGKPSKHYKSDKNDANQRGV
TPPSEESRPRPNHQHRNEGGNKQGKRKRRPRHPYRGNKDQQSS