Protein Info for B158DRAFT_0540 in Kangiella aquimarina DSM 16071

Annotation: ABC-type Fe3+ transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13531: SBP_bac_11" amino acids 55 to 312 (258 residues), 42.3 bits, see alignment E=1.6e-14 PF01547: SBP_bac_1" amino acids 64 to 309 (246 residues), 51.2 bits, see alignment E=3.9e-17 PF13416: SBP_bac_8" amino acids 69 to 338 (270 residues), 69.6 bits, see alignment E=8e-23 PF13343: SBP_bac_6" amino acids 102 to 328 (227 residues), 60.4 bits, see alignment E=3.9e-20

Best Hits

Swiss-Prot: 55% identical to P5217_PSEAE: Probable binding protein component of ABC iron transporter PA5217 (PA5217) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 89% identity to kko:Kkor_2460)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>B158DRAFT_0540 ABC-type Fe3+ transport system, periplasmic component (Kangiella aquimarina DSM 16071)
MKKTWLTGLSASVLLVLSACSDESAQSSDTQAQSPEAQNTTQTTAQAQQNDTPIVVYTSR
KEHLVKPFFEQFTAETGIDIQYITDSEAALISRLKAEGERTPADVLITVDAGNLWLATQE
DVLQPIESPVLEASIPESLQDPENHWFGLTVRARTIVYSTERVKPEELATYEALGDEQWS
GRLCLRTSKKVYNQSLVAMLIARYGEEKTQQIVESWVANLATDPFSNDTKVMNAITAGVC
DVGVVNTYYFGRLQKETPDIPLALFWPDQSEEGYGVHVNVSGAGITKHSDNQQNALKLIE
WLASEEAQQMFAGLNMEYPANKNVKPTEEVAAWGEFKADTTNLSKAGELQPAAVKLMDRA
GYR