Protein Info for B158DRAFT_0521 in Kangiella aquimarina DSM 16071

Annotation: PEP-CTERM-box response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 TIGR02915: PEP-CTERM-box response regulator transcription factor" amino acids 9 to 449 (441 residues), 708.4 bits, see alignment E=1.8e-217 PF00072: Response_reg" amino acids 10 to 121 (112 residues), 64.6 bits, see alignment E=2.8e-21 PF00158: Sigma54_activat" amino acids 148 to 314 (167 residues), 241 bits, see alignment E=1.7e-75 PF14532: Sigma54_activ_2" amino acids 150 to 319 (170 residues), 74.5 bits, see alignment E=3e-24 PF07728: AAA_5" amino acids 172 to 290 (119 residues), 33.9 bits, see alignment E=8.9e-12 PF02954: HTH_8" amino acids 407 to 447 (41 residues), 38 bits, see alignment 3.4e-13

Best Hits

KEGG orthology group: K02481, two-component system, NtrC family, response regulator (inferred from 98% identity to kko:Kkor_2476)

Predicted SEED Role

"Response regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>B158DRAFT_0521 PEP-CTERM-box response regulator transcription factor (Kangiella aquimarina DSM 16071)
MAQSNKPDLLIIEDDKGLQKQLKWSFDQYNVILAEDRDSALVELRRYQPQVITLDLGLPP
DPANASVGLELLEEILSLSPTSKVIVVTGNDQREIAMQAVNAGAYDYYQKPIQPEELTLI
IKRAFELAKLEDDNRRHFQQQKESFHGIIATSPEMMGVCQKIEKVAPTDVSVLLLGDSGT
GKELLARAIHDISPRRSKNMVAINCAAIPDNLLESELFGYEAGAFTGANKTTMGKIEYAN
GGTLFLDEIGDMPMALQAKLLRFLQERVVERVGGRESIPVDVRIIAATHHTLEDLVNEGK
FREDLFYRLSEVVLNIPALSKRNGDVVLIARSLLEKFNRQYSRNIRGFSKDAVQAMEAYS
WPGNVRELENKIKSAVVMSDSNQITAKDLQIDEAQLREMPLNLRQVREAAETRAIQRAIV
LSDGNISQAAKLLGLTRPTLYSLMDKYSISS