Protein Info for B158DRAFT_0520 in Kangiella aquimarina DSM 16071

Annotation: putative PEP-CTERM system histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 47 (17 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details TIGR02916: putative PEP-CTERM system histidine kinase" amino acids 111 to 658 (548 residues), 403.4 bits, see alignment E=1.1e-124 PF02518: HATPase_c" amino acids 555 to 658 (104 residues), 55.5 bits, see alignment E=3.8e-19

Best Hits

KEGG orthology group: None (inferred from 93% identity to kko:Kkor_2477)

Predicted SEED Role

"Sensory transduction histidine kinases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (665 amino acids)

>B158DRAFT_0520 putative PEP-CTERM system histidine kinase (Kangiella aquimarina DSM 16071)
MAGFIACIVLAGFLFMTVLLRWRGSTLGWPIMLLALTFIGWSGLNLVDTDSELNHWIIEW
ARLFGIFAALTFFLFYFATHHKLLSVIIIIAFIGWASFILLYSGDMKRVINPAIAGFILL
MMMQMMERAGNQFAETLRAEISTLGGALGIVLIWDLLSMLVLMLNLNVDAEALDVSRAII
ASIAIAFSLVHIQRIDQSRLDLENIQQTYRPQSSLNIFAVLCWLAVVGYMLIGVAWQKPF
AGSVVLAASILIFIWLAYKKKLLSQLKIMFTKLFASYKYDYRESWLGFNRALDEANVQGD
FYQLSIKALANIISSPAGKLWSRRGDLFIYTDNWQSPLNSPLNNELAYQLPMELIDFIER
TNWVVDIKEYQSNQNVYQGLKLDHHSPLFQQHQIFIPLRRGEELVAVVGLRSSYSKPSLN
WEDHDLLKAAGQQMASYLALFEATTQIYEREQFDAFNRLSAFVVHDLKNVTAQLELITHN
AHRYRDNPEFVDDTFETVASATQRLNKMLEQLQRKQLPKKEILQAFIPEVFAKFKESASR
LNVIGDIPEVEVYANQDQLLNIIQHLHQNAIDASNESDRIHHRFDQIGQELHWHIVDKGK
GMDPDFVRKQLFKPFATTKGNAGMGIGVYQCRYLLQSFGGDLIIQSELGKGTRCIVILQT
LTPGD