Protein Info for B158DRAFT_0503 in Kangiella aquimarina DSM 16071

Annotation: ribosome biogenesis GTP-binding protein YsxC/EngB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR03598: ribosome biogenesis GTP-binding protein YsxC" amino acids 6 to 190 (185 residues), 239.9 bits, see alignment E=8.4e-76 PF01926: MMR_HSR1" amino acids 25 to 142 (118 residues), 60.5 bits, see alignment E=8.4e-21

Best Hits

Swiss-Prot: 59% identical to ENGB_IDILO: Probable GTP-binding protein EngB (engB) from Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

KEGG orthology group: K03978, GTP-binding protein (inferred from 87% identity to kko:Kkor_2490)

Predicted SEED Role

"GTP-binding protein EngB" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>B158DRAFT_0503 ribosome biogenesis GTP-binding protein YsxC/EngB (Kangiella aquimarina DSM 16071)
MNYHTAKYLLGAAKLAQLPPDEGIEVAFAGRSNAGKSSALNTLTQQKSLARTSKTPGRTQ
LINVFTLDEDRRLIDLPGYGYAKVPEAMKLQWQEELSRYLQQRQCLRGLVLLMDIRHFLK
DSDQDMLAWAAEVGLPVHCLLSKADKLKQGAKSKAVLQCKKAVKELHPTATVQAFSSLKR
EGLDQLYKILDEWYHPSEEPEEQTE