Protein Info for B158DRAFT_0490 in Kangiella aquimarina DSM 16071

Annotation: rarD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 149 to 165 (17 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 265 to 286 (22 residues), see Phobius details PF00892: EamA" amino acids 7 to 139 (133 residues), 57.5 bits, see alignment E=8.7e-20 TIGR00688: protein RarD" amino acids 7 to 258 (252 residues), 224.7 bits, see alignment E=7.2e-71

Best Hits

Swiss-Prot: 42% identical to RARD_ECOLI: Protein RarD (rarD) from Escherichia coli (strain K12)

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 92% identity to kko:Kkor_2513)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>B158DRAFT_0490 rarD protein (Kangiella aquimarina DSM 16071)
MQNVNRAGYIYGILAFVIWGLAPIYFKALEGVSALEILAHRVAWSVPVVLIIMWAIKRPF
PKNILQDKKTIGILIATSVLISGNWLAFTWAVTNERVLETSLGYFINPLFSVALGILFLK
EKLTTWSKIALLLATLGVLYRIFSLGSLPWISLWLAFSFGVYGLLRKQVNIGPLQGLLVE
TLIVLPFTAGYIIYLWYTGTGAFLHTSASIDWLLLAGGVITTVPLALFSAGARLLPLNTI
GFMQYLAPSLTFLLAVFAFKETFNVDLLITFGLIWAGLIIYTIGVVRQQNQKRRDRKSAA
KLMENQ