Protein Info for B158DRAFT_0477 in Kangiella aquimarina DSM 16071

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 427 to 448 (22 residues), see Phobius details PF13424: TPR_12" amino acids 158 to 220 (63 residues), 31.5 bits, see alignment E=7.7e-11 PF17874: TPR_MalT" amino acids 199 to 386 (188 residues), 31.9 bits, see alignment E=3.9e-11 PF13181: TPR_8" amino acids 230 to 260 (31 residues), 16.5 bits, see alignment (E = 3.4e-06) TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 459 to 620 (162 residues), 151.9 bits, see alignment E=6.8e-49 PF00990: GGDEF" amino acids 461 to 618 (158 residues), 139 bits, see alignment E=5.8e-44

Best Hits

KEGG orthology group: None (inferred from 84% identity to kko:Kkor_2531)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (624 amino acids)

>B158DRAFT_0477 diguanylate cyclase (GGDEF) domain (Kangiella aquimarina DSM 16071)
MVKLKSLLMVLLLLASSQTYSASPADNIPLQNQLYAMGKLSIPERSQDSFLNKLQTILNN
DLDPHSEALANILVADYYIHTNDPLRAREFLNIATPLVNTVDKASLYQEFNYVLMLVLRT
EGKIKEAKRTADALYRDVRESWPDNKLSDIVLERAYINSYMYRYQEAFELMELALSHAYE
SDDPFQLVETYNVFSILYGALNDYPSAIDYLKKSIEIMEANPKFTQNTYLYVNLADSYRA
AEDFEQADAYLDKSFQIAKDTGDISLRAYAHQVKGRLLIDQKNYEAALNHILTSQELHKE
VGEELFSFEIHTELATIYLELGQLDKANQHLVIAKEYAVQLGSQDTHYINRLESQLAFKS
GNFEQAYELLNESYTQYRKQFNDNLTYVSNLSREQLDQERLVFENKLLEQENILNAQYVQ
ESRKYSYILWVLILLLLLVVCIALWIMLRYRSVARTNHRMAYTDNLTKLPNRRHVFRTLE
LQHRSSGQTRKPYSVILFDIDFFKSINDRFGHNVGDRVIQATRNICEAILRDSDTVGRIG
GEEFLILLPDTGIKEAYSIAERLREYFECYNFDDLAPGLTVTSSFGVTEYMPDDETLDLV
INRADRLLYKAKNEGRNQVMASFA