Protein Info for B158DRAFT_0460 in Kangiella aquimarina DSM 16071

Annotation: NADPH-glutathione reductase (EC 1.8.1.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 177 to 193 (17 residues), see Phobius details TIGR01421: glutathione-disulfide reductase" amino acids 6 to 453 (448 residues), 682.3 bits, see alignment E=2e-209 PF07992: Pyr_redox_2" amino acids 9 to 320 (312 residues), 236.2 bits, see alignment E=1.4e-73 PF13738: Pyr_redox_3" amino acids 122 to 304 (183 residues), 49.7 bits, see alignment E=8.2e-17 PF00070: Pyr_redox" amino acids 171 to 249 (79 residues), 75 bits, see alignment E=1.4e-24 PF02852: Pyr_redox_dim" amino acids 342 to 452 (111 residues), 111.2 bits, see alignment E=7.5e-36

Best Hits

Swiss-Prot: 62% identical to GSHR_ECOLI: Glutathione reductase (gor) from Escherichia coli (strain K12)

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 88% identity to kko:Kkor_2548)

MetaCyc: 62% identical to glutathione reductase (NADPH) (Escherichia coli K-12 substr. MG1655)
Glutathione-disulfide reductase. [EC: 1.8.1.7]

Predicted SEED Role

"Glutathione reductase (EC 1.8.1.7)" in subsystem Glutathione: Redox cycle (EC 1.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>B158DRAFT_0460 NADPH-glutathione reductase (EC 1.8.1.7) (Kangiella aquimarina DSM 16071)
MSNNIKHYDFLAIGAGSGGIASANRAAIRGAKAAVIEAKSVGGTCVNVGCVPKKVMWYGA
HIAEAIKYSEAYGFNLEQTGFEWSRLVKNREAYIERIHGAYHRGFESNGVDFIEGYARFV
DDHTVEVNGEKISADHIVIAVGGRSIIPDVPGAEHGIDSDGFFALNERPKKALVVGAGYI
AVEIAGVLHALGANAHLLVRKDRPLRYFDRDITDALLDRLKQDGPVLHTHTEVSKIEKDD
KGLLQVHTNKGCIENVDCLIWAIGREPATDDLGLEAAGVKADEEGFIFTDKYQQTNVEGI
YAVGDITGEAQLTPVAIKAARLLAERLFNPAMSNAHMDYSQIPTIVFSHPPIGSLGLTED
EAIERFGADDIKVYKSQFAAMYNAVTPHRAISTFKLVCQGKNEMVVGIHGIGEGMDEILQ
GFAVAMKMGATKADFDATVAIHPTSAEEFVTLR