Protein Info for B158DRAFT_0458 in Kangiella aquimarina DSM 16071

Annotation: cytidyltransferase-related domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 2 to 66 (65 residues), 67.5 bits, E=4.6e-23
• PF01467: CTP_transf_like
  • amino acids 4 to 124 (121 residues), 83.8 bits, E=6.5e-28

Best Hits

Swiss-Prot: 49% identical to TARD_BACPZ: Glycerol-3-phosphate cytidylyltransferase (tarD) from Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)

KEGG orthology group: K00968, choline-phosphate cytidylyltransferase [EC: 2.7.7.15] (inferred from 92% identity to kko:Kkor_2550)

MetaCyc: 48% identical to glycerol-3-phosphate cytidylyltransferase monomer (Bacillus subtilis subtilis 168)
Glycerol-3-phosphate cytidylyltransferase. [EC: 2.7.7.39]

Predicted SEED Role

"Glycerol-3-phosphate cytidylyltransferase (EC 2.7.7.39)" in subsystem Rhamnose containing glycans (EC 2.7.7.39)

MetaCyc Pathways

• 1-(sn-glycero-1-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
• 1-(sn-glycero-3-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
• cell-surface glycoconjugate-linked phosphocholine biosynthesis (1/3 steps found)
• choline biosynthesis III (1/3 steps found)
• phosphatidylcholine biosynthesis I (1/3 steps found)
• phosphatidylcholine biosynthesis II (1/5 steps found)
• lipid A-core biosynthesis (P. gingivalis) (1/7 steps found)
• poly(3-O-β-D-glucopyranosyl-N-acetylgalactosamine 1-phosphate) wall teichoic acid biosynthesis (2/10 steps found)
• poly(glycerol phosphate) wall teichoic acid biosynthesis (2/11 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis I (B. subtilis) (2/12 steps found)
• superpathway of choline biosynthesis (1/12 steps found)
• superpathway of phosphatidylcholine biosynthesis (1/12 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis II (S. aureus) (2/14 steps found)
• superpathway of phospholipid biosynthesis II (plants) (11/28 steps found)
• plasmalogen biosynthesis I (aerobic) (2/16 steps found)
• type IV lipoteichoic acid biosynthesis (S. pneumoniae) (1/18 steps found)

KEGG Metabolic Maps

• Aminophosphonate metabolism
• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.15 or 2.7.7.39

Protein Sequence (133 amino acids)

>B158DRAFT_0458 cytidyltransferase-related domain (Kangiella aquimarina DSM 16071)
MRVITFGTFDVFHVGHVNILERARALGTELYVGVSSDQLNFNKKGRYPIYSEEDRMHILS
ALTCVDFVFLEESLEKKSEYIQQYNADLLVMGDDWQGKFDEMKQFCDVKYLPRTPSISTT
EIIEVVRHIPIKD