Protein Info for B158DRAFT_0440 in Kangiella aquimarina DSM 16071

Annotation: Cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 61 (61 residues), see Phobius details amino acids 64 to 65 (2 residues), see Phobius details transmembrane" amino acids 62 to 63 (2 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details PF18075: FtsX_ECD" amino acids 79 to 172 (94 residues), 61.9 bits, see alignment E=7.3e-21 PF02687: FtsX" amino acids 197 to 317 (121 residues), 40.2 bits, see alignment E=3.2e-14

Best Hits

Swiss-Prot: 32% identical to FTSX_ECOL6: Cell division protein FtsX (ftsX) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 89% identity to kko:Kkor_2568)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>B158DRAFT_0440 Cell division protein (Kangiella aquimarina DSM 16071)
MSKSSRQNTTYKISFIDRFRMAITLHKKNAMTTLLDVFRHPANSLLTILVLAIALALPSA
FYVFSSNAKAISSNWSGGVQMALFLKDNVNQQQRADLIQELSFRPEFKEVVLVPKEEAIE
EFKQQSGFGDALDYLNENPLPDSIILTPYETHADAASLEQLAQELEQNPMVDIAQLDMAW
IQRYQAILEISQKIGTFVSILLAFGVLLIVGNTIRLAILNRREEIQVIKLVGATDAFIRR
PFLYSGFWYGLIAALLAALMVNIVLFLLLQPSSTLAELYNSGFSLIGLAPTQTLSLLAIG
SALGLFGAWFSVSKHLKDIQPT