Protein Info for B158DRAFT_0417 in Kangiella aquimarina DSM 16071

Annotation: UbiD family decarboxylases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 6 to 455 (450 residues), 582.1 bits, E=3.3e-179
• PF20695: UbiD_N
  • amino acids 10 to 89 (80 residues), 104.7 bits, E=3.3e-34
• PF01977: UbiD
  • amino acids 122 to 322 (201 residues), 283.7 bits, E=9.2e-89
• PF20696: UbiD_C
  • amino acids 328 to 452 (125 residues), 165.3 bits, E=9.8e-53

Best Hits

Swiss-Prot: 81% identical to UBID_ALTMD: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD1) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 97% identity to kko:Kkor_2591)

MetaCyc: 76% identical to 3-octaprenyl-4-hydroxybenzoate decarboxylase (Escherichia coli K-12 substr. MG1655)
3-OCTAPRENYL-4-OHBENZOATE-DECARBOX-RXN [EC: 4.1.1.98]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• superpathway of chorismate metabolism (41/59 steps found)
• plastoquinol-9 biosynthesis II (1/5 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.98

Protein Sequence (495 amino acids)

>B158DRAFT_0417 UbiD family decarboxylases (Kangiella aquimarina DSM 16071)
MQYKDLRDFIAKLESMGELKRVSVEVDPYLEMTEICDRTLRAGGPAILFENVKGHSIPVL
GNLFGTTRRVALAMGKEDLTGLRELGELLAFLKEPKPPEGFKDAWQQLPVFKQVLNMAPK
VVKKAPCQKVVLEGDEVDLSKIPVQTCWPEDAAPLMTWGLTITKGPHKKRQNLGIYRQQV
IAKNKLIMRWLAHRGGALDFREWCQQNPGQPFPVSVAFGADPATILGAVTPVPDTLSEYG
FAGLLRGEKTEVVKSIGNDLQVPASAEFVLEGYIDPEEMADEGPYGDHTGYYNEVDSFPV
FTVERITMREEPIYHSTYTGRPPDEPAILGEALNEVFVPILQKQFPEIVDFYLPPEGCSY
RLAIVSMKKQYPGHAKRIMMGVWSFLRQFMYTKFVIVVDDDVNTRDWKDVIWAITTRVDP
TRDCTMIDNTPIDYLDFASPVSGLGSKMGIDATNKMPGETEREWGKPIVMDQAVKDRVDT
LWDELGLDIDDKDNP